SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014684589.1.15941 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014684589.1.15941
Domain Number 1 Region: 4-122
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.5e-58
Family Nqo15-like 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014684589.1.15941
Sequence length 123
Comment NADH dehydrogenase [Deinococcus gobiensis]; AA=GCF_000252445.1; RF=representative genome; TAX=745776; STAX=502394; NAME=Deinococcus gobiensis I-0; strain=I-0; AL=Complete Genome; RT=Major
Sequence
MTHSDSALYAGWTELLGWLEAEAQARGLTYGKVADFPDYIYRMERPYDLPTTVMSAGVSS
GGQPLLVAAVSPRHADLKAVSLRLMGGSKHWHLHAGTRGLLEGKRPFTRERLGAVLDGAL
RGL
Download sequence
Identical sequences H8GRQ9
WP_014684589.1.15941 gi|386856387|ref|YP_006260564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]