SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014687308.1.1565 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014687308.1.1565
Domain Number 1 Region: 212-326
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-32
Family NlpC/P60 0.0024
Further Details:      
 
Weak hits

Sequence:  WP_014687308.1.1565
Domain Number - Region: 34-236
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0107
Family Phase 1 flagellin 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014687308.1.1565
Sequence length 330
Comment hypothetical protein [Actinoplanes sp. SE50/110]; AA=GCF_000237145.1; RF=na; TAX=134676; STAX=134676; NAME=Actinoplanes sp. SE50/110; strain=SE50/110; AL=Complete Genome; RT=Major
Sequence
MLATRHAAALRRRGWTVALLAAVLSLGMTAPARANPSPQQIEKQLDQQWNQLEPTIEQYN
QVHTQLQTSRSQQQKLTKQLQPLQARVDAAMSGVGQLASRAYMQGGDIALSSLLISGNPA
DLTDKLTYLDVMASSRRSQVAGVITLRDKYASDKKQLDTVTASLAARDADLAAKKNTIQK
KINDLQQLRVKAYGAGGGASGNLRTGACPATYTNDPGGKAAAKACSLIGKPYIWADAGPD
GYDCSGLTLAAWATVGVSLRHYTKWQWEDTKPVSRADLKPGDLVFWYSDLHHMGMYVGNN
TVVHAPHTGDFVRMAGLDAVGPVAGFRRPS
Download sequence
Identical sequences G8S7U1
WP_014687308.1.1565 WP_014687308.1.34629 gi|386845284|ref|YP_006263297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]