SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014691080.1.34629 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014691080.1.34629
Domain Number - Region: 7-46
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0366
Family Achaeal helicase C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014691080.1.34629
Sequence length 76
Comment hypothetical protein [Actinoplanes sp. SE50/110]; AA=GCF_900119315.1; RF=na; TAX=134676; STAX=134676; NAME=Actinoplanes sp. SE50/110; AL=Complete Genome; RT=Major
Sequence
MRDDRQATETTETDARSTLLDLVARVPFGVQAAVLAGVLVAGVGVADTGRTEARAAEVVT
AFGIASTTCCPPPDPR
Download sequence
Identical sequences G8S6X9
gi|386849063|ref|YP_006267076.1| WP_014691080.1.1565 WP_014691080.1.34629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]