SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014713198.1.25520 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014713198.1.25520
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.18e-52
Family ADP-ribosylglycohydrolase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014713198.1.25520
Sequence length 284
Comment ADP-ribosylglycohydrolase [Streptococcus parasanguinis]; AA=GCF_000963285.1; RF=na; TAX=1318; STAX=1318; NAME=Streptococcus parasanguinis; strain=VT517; AL=Contig; RT=Major
Sequence
MLGAIVGDIVGSVYEWSNIKTKDFPLFREDCFFTDDTVMTCAVAEAIMNGGQKDDFIDAM
KKYGRMYPDAGYGARFNTWVQSNDCSPYNSFGNGSAMRVSPCAWVMDCGFCARTGTWPSS
RNLVRISAEVTHNHPEGIKGAMATSDAIFLCRYYFGGYCGDYEQPINDHPTECKRRIKEY
IEKEYGYNLSQSLDDIRPNYHFNETCQDTVPQAIIAFLESTDFEDAIRNAISLGGDSDTL
AAITGSIAEAAYGIPDWIKDKAYTYLDDPLKDVLSRWEQEVSIT
Download sequence
Identical sequences I1ZLG3
gi|387879398|ref|YP_006309701.1| WP_014713198.1.15754 WP_014713198.1.25520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]