SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014760647.1.20455 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014760647.1.20455
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.81e-30
Family Cystathionine synthase-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014760647.1.20455
Sequence length 183
Comment cystathionine gamma-synthase [Bifidobacterium bifidum]; AA=GCF_000155395.1; RF=na; TAX=398513; STAX=1681; NAME=Bifidobacterium bifidum NCIMB 41171; strain=NCIMB 41171; AL=Scaffold; RT=Major
Sequence
MAALAATFTTVLNRGDHAIFSDTAGALLSVDNTFNSPFNAWLINRGSVTMPLRMRQHNAS
AQAIAEHLQSLPQVRFVAYPGLESHPHHAFAASQLARPDAGFGGVLAFGLNTDHDGHNRF
VSKLNVITSAVSLGHDESLIVFLGEDDERQYLYPPGFHQGFFRLAVGLEDTDDLIRDIDH
ALS
Download sequence
Identical sequences A0A0M4LMI9 I3WJY0
WP_014760647.1.10423 WP_014760647.1.12576 WP_014760647.1.20455 WP_014760647.1.61429 WP_014760647.1.81148 gi|390937513|ref|YP_006395072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]