SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014767753.1.2099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014767753.1.2099
Domain Number 1 Region: 19-254
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 1.7e-70
Family Purine and uridine phosphorylases 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014767753.1.2099
Sequence length 284
Comment uridine phosphorylase [Desulfurococcus amylolyticus]; AA=GCF_000231015.2; RF=na; TAX=768672; STAX=94694; NAME=Desulfurococcus amylolyticus DSM 16532; strain=DSM 16532; AL=Complete Genome; RT=Major
Sequence
MSERLKSASRPESEEGRLYHLQVKPGDVSRYILLPGDPDRVPWIASFWDKAWSVAKHREY
VTYSGYYKGVFISATSTGIGAPATAIAIEELARVGGDTFIRVGTTGALTRSISVGDIIIS
TGAVRLEGTSKHYVMPEYPAVASYDVVLALIEAAEILGVRYHVGLTASSDSFYVGQERPG
FKDYLPPFQRGLVQYLRSVNVLNFEMEAALIFTLANIYGLRAGAVCAAIANRETEEFVVN
AGVEDAIKVANEAVKILSEWDEEVKRRGKKYISASIIKQTASKH
Download sequence
Identical sequences I3XSD1
WP_014767753.1.2099 gi|390938692|ref|YP_006402430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]