SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014788705.1.33015 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014788705.1.33015
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily LigT-like 1.74e-45
Family 2'-5' RNA ligase LigT 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014788705.1.33015
Sequence length 184
Comment RNA 2',3'-cyclic phosphodiesterase [Thermococcus cleftensis]; AA=GCF_000265525.1; RF=representative genome; TAX=163003; STAX=163003; NAME=Thermococcus cleftensis; strain=CL1; AL=Complete Genome; RT=Major
Sequence
MRAFIAIEVSDEVRDNLLKAQERIGSKSAKIKFVERENFHVTLKFLGEIDEITAEEVKRA
LEEIAKKHKKHRVRVKGIGVFPNPNYVRVIWAGIENDEGIKAIARDVEREMRRLGFKKEK
DFVAHITIGRVKFVRDKLELAMALKDLANEDFGEFDVEAIELKKSTLTPKGPIYETVARF
ELAE
Download sequence
Identical sequences I3ZTN6
WP_014788705.1.33015 gi|390961030|ref|YP_006424864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]