SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014795284.1.96982 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014795284.1.96982
Domain Number 1 Region: 213-403
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.76e-65
Family Methylesterase CheB, C-terminal domain 0.00000797
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily CheY-like 1.71e-28
Family CheY-related 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014795284.1.96982
Sequence length 404
Comment chemotaxis response regulator protein-glutamate methylesterase [Desulfitobacterium dehalogenans]; AA=GCF_000243155.2; RF=representative genome; TAX=756499; STAX=36854; NAME=Desulfitobacterium dehalogenans ATCC 51507; strain=ATCC 51507; AL=Complete Genome; RT=Major
Sequence
MNQPKSPITVLIVDDSPFMRLTLQKILSQDPDIKVLDTARDGKEGIEKLQVLRPQVVTMD
IEMPQIDGLQALSEIMRWQPTPVIILSALTTEGAQASVKALEAGAFDVVAKPSGGPGADI
QALARDLIDKVKAAAQVDPGRLNKKGSVSRTPTNPGSRPAWTAGTAGENVPRAGTSTYQS
SPQGLPSPGNAGSILGSPKGRSLDGGEGLPRYPVEIVAIGTSTGGPSALQAVLTQLPGNF
PVPVLVAQHMPPGFTAPLAQRLNGMSPLTIREGVHGEVLKAGTIYFAPAGKQMQVQSRGS
QLFLHIGDESPITTLYHPSVDVMFLSLAKEVGKGTLGVVMTGMGNDGLRGMREIKERGGY
AIAEAEETCVVYGMPRAIVDAGLANRVVPLGEIARHIVECVQRR
Download sequence
Identical sequences I4ACX5
gi|392395001|ref|YP_006431603.1| WP_014795284.1.96982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]