SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014801624.1.12531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014801624.1.12531
Domain Number 1 Region: 7-196
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.4e-65
Family Methylesterase CheB, C-terminal domain 0.00000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014801624.1.12531
Sequence length 200
Comment chemotaxis protein CheB [Turneriella parva]; AA=GCF_000266885.1; RF=representative genome; TAX=869212; STAX=29510; NAME=Turneriella parva DSM 21527; strain=DSM 21527; AL=Complete Genome; RT=Major
Sequence
MNALYHHASKLVAIGASAGGPHAIETVLGELGADMPPILITQHMPEVFTRAFARRLDEIM
ALTVVEADATEKLKSGTVYIAPGDRHLIVRRQGLELFATTDAGPPVNRHRPSVDVLFESV
VSAAPASAMGIILTGMGNDGARGLAAMRHAGFLTIAQDEATSVVWGMPREAVKLEAVDGS
HILPLSKIGPAIKNFVKLPI
Download sequence
Identical sequences I4B1E7
WP_014801624.1.12531 gi|392401998|ref|YP_006438610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]