SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014804219.1.12531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014804219.1.12531
Domain Number 1 Region: 52-407
Classification Level Classification E-value
Superfamily SIS domain 7.37e-71
Family Phosphoglucose isomerase, PGI 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014804219.1.12531
Sequence length 416
Comment phosphoglucose isomerase (PGI) [Turneriella parva]; AA=GCF_000266885.1; RF=representative genome; TAX=869212; STAX=29510; NAME=Turneriella parva DSM 21527; strain=DSM 21527; AL=Complete Genome; RT=Major
Sequence
MSHEVRFSANKFWMNWQSMGRAQELDALMHAGFRKWPAAFSTDYMKTSELAPLEKWAAEL
RQLDAQTLIVIGIGGSSLGGIALKALIDAHSDRLIFWEGPHPSKMQKIAQIAEQKQTAVL
VVSKSGTTLETRANLSLFRQFFPGVPEYFVTSEPAAIKDLGANSKNTFLIPKDLGGRFSI
VSPVGMMPAMFVDYNVKAFLTAFDEANAEWEISIPVAENVAKQTAIHFYNLFAARFTGVA
FWVYAADLVDWGRWLVQLWAESLGKKPHIAALPMIVQGPEDQHSLLQYFMEASNRHLHCF
VHTQSYGSRDSLISSEIRGDFADKSMSQILNAQMKSIESALSAKERPVAEYMLSDLSETE
MARWFCFWMHVVSYLGYLWEINPFDQPGVEAGKIICKKLLRGENVEEAVQPVFDLR
Download sequence
Identical sequences I4B8W1
WP_014804219.1.12531 gi|392404612|ref|YP_006441224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]