SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014827289.1.101568 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014827289.1.101568
Domain Number 1 Region: 453-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000194
Family Anti-sigma factor antagonist SpoIIaa 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014827289.1.101568
Sequence length 609
Comment sodium-independent anion transporter [Desulfosporosinus acidiphilus]; AA=GCF_000255115.2; RF=representative genome; TAX=646529; STAX=885581; NAME=Desulfosporosinus acidiphilus SJ4; strain=SJ4; AL=Complete Genome; RT=Major
Sequence
MNLTRFRYIPIIGTLKNYKKEYFTKDLIAALTVAVVAIPQSMAYALIAGVNPVYGLYTAI
ISSILGSMFGSSKHLVTGPTNAICLLVAASMRNYMGLDNAYQMLFLMTLLVGALQMLYGI
IKLGKVINFVSHSVIVGFTAGAGVLIALGQLNTILSISIKNSAQLPTMEKLYYVLTHISQ
TNYYALGLGLLTIAIILICKKINKNLPGALIGIVIPILIIVMFGLDQKGVKLTGAIPSSL
PPFKMVQFSFDSLNKVFSGAVAISIIGLVEAISISKSIASTSRQKIDANQEFMGQGISNI
ISSFFQCFPSSGSFTRSAINYYNGAVTRMAAIMSGIVIAIVLLFFAPYAQYIPNPCLAGV
ILVTAYSLIDQEEIKRIVKLGKFSSDSLAMAITCLATILMPDLDYAIYSGIVISIILYLK
DTNKAPVRLFIPILEEDSRISRQELEVIDNKTDLLIIQLEGHLYFGSAFDLEQKLDNLVG
KAKLCILKMENVSSLDATAINALKIFIKSVKRYGGETIICGARPKINTILLKANLEKELE
RDYKFTLSEEEILNSVAITTENERTVLSCEKDNSVVNNFAYHLLQSVTNFNGGNSSNKKT
TYLENSSVN
Download sequence
Identical sequences I4D662
WP_014827289.1.101568 gi|392425624|ref|YP_006466618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]