SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014839261.1.6818 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014839261.1.6818
Domain Number 1 Region: 14-264
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.76e-45
Family Phosphate binding protein-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014839261.1.6818
Sequence length 267
Comment amino acid ABC transporter substrate-binding protein [Klebsiella michiganensis]; AA=GCF_000276705.2; RF=na; TAX=1191061; STAX=1134687; NAME=Klebsiella michiganensis E718; strain=E718; AL=Complete Genome; RT=Major
Sequence
MNKTLKKISRRVALSIAVTACFSPLAQAAELLTEGVFKVGMEVTYPPFESYDSNNNIVGI
DPEFAALIAEQLKAKPQLIDTKFTSLILGIGKKYDAVISGMYVTPERQKQADAIPYALSG
ASIIALKSSAIQPKTEDELCGVKVGLQAGTAWVSSLKTHSDEYCLKNGKPAISIQEFPTA
PEASQALLSKNINAQLEIAPAAQIIVEKSRGRLAISSNRLVYPLPLGIYVAKGNTELAEA
IKSTLATLKANGKYDTIIKKYNLESIN
Download sequence
Identical sequences A0A249WL61
WP_014839261.1.18452 WP_014839261.1.6818 gi|397659472|ref|YP_006500174.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]