SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014864617.1.66429 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014864617.1.66429
Domain Number 1 Region: 14-303
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.09e-52
Family Diacylglycerol kinase-like 0.0000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014864617.1.66429
Sequence length 323
Comment diacylglycerol kinase [Natrinema sp. J7-2]; AA=GCF_000281695.1; RF=na; TAX=406552; STAX=406552; NAME=Natrinema sp. J7-2; strain=J7-2; AL=Complete Genome; RT=Major
Sequence
MDGSMTPVETSDRVLVLNPVSGSGDHVDDVVELAADHGFEIRRTEQGGDATRFAREAAPE
AALVAAAGGDGTLNAVVNGVAAANALETTTVAVVPAGTGNNFATNVGIRGLEHAFTVIED
GRRRAIDVAMANGRRFVNSCVGGITAEASSDTTTESKADLGVLAYVKNTIETVGEFDSLP
LRVETAAGPNGETAQSWEGEALFVLIGNCRRFTGARTAQANVEDGLLEVTIVEDAATTDL
LGGAALEGLLGQDSTHIVRRRTPSLAIDSRADSIEYSLDGEILETETVRIETDPGALTLP
VGDGYRPDPDDEERWPIGTPANQ
Download sequence
Identical sequences I7BY56
gi|397774435|ref|YP_006541981.1| WP_014864617.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]