SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014866899.1.51038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014866899.1.51038
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.11e-24
Family Hypothetical protein PH1932 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014866899.1.51038
Sequence length 180
Comment TrmB family transcriptional regulator [Methanoculleus bourgensis]; AA=GCF_000304355.2; RF=representative genome; TAX=1201294; STAX=83986; NAME=Methanoculleus bourgensis MS2; strain=MS2T; AL=Complete Genome; RT=Major
Sequence
MEPVDIVLTKDTFEVLASETRLDILKTLSTRRMTVTELADTLDLAKSTVHHHLQRLADAG
LVAADDDGRAWVYYALTQEGQGLLQPHDGTRIRVLLAAGLASLVGGVCAVVAFLTAPVRE
GPVSPRPGGGGLPVPAGPPVELLVAGIALAVIGGILVAYACIRWRNRRATEDFCAGEEVT
Download sequence
Identical sequences I7J866
WP_014866899.1.51038 gi|397780166|ref|YP_006544639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]