SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014867754.1.63524 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014867754.1.63524
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000214
Family Iron-dependent repressor protein 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014867754.1.63524
Sequence length 92
Comment MULTISPECIES: hypothetical protein [Methanoculleus]; AA=GCF_900036045.1; RF=na; TAX=86622; STAX=86622; NAME=Methanoculleus sp. MAB1; AL=Complete Genome; RT=Major
Sequence
MREEDLDWAVYHQIPENGGVTTGDLVAATGFEPSAVTASLERLERYLLIRRSGETVRLLS
VQESLVECRCRYTVDLPFVIENGVIKAKRRDE
Download sequence
Identical sequences A0A0X3BN35 A0A167SY56 I7KDF5
gi|397781024|ref|YP_006545497.1| WP_014867754.1.51038 WP_014867754.1.63524 WP_014867754.1.88179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]