SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014868579.1.26313 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014868579.1.26313
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.88e-29
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014868579.1.26313
Sequence length 107
Comment PTS lactose transporter subunit IIA [Melissococcus plutonius]; AA=GCF_000283975.1; RF=na; TAX=1090974; STAX=33970; NAME=Melissococcus plutonius DAT561; strain=DAT561; AL=Complete Genome; RT=Major
Sequence
MNKEEVQLLGFEIVAYSGDARSELLTLLNETRQGNFEHVNEHLKNVDENLKLAHNSQTQT
LADEAAGKNMEMGFIFIHGQDHLMTTLLFRDLIQDFIELYREKYQKN
Download sequence
Identical sequences H5T6V2
gi|399140297|ref|YP_006546398.1|NC_018265 WP_014868579.1.26313 gi|399140297|ref|YP_006546398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]