SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014868919.1.68585 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014868919.1.68585
Domain Number 1 Region: 3-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.58e-104
Family AAT-like 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014868919.1.68585
Sequence length 397
Comment aspartate aminotransferase [Wolbachia endosymbiont of Onchocerca ochengi]; AA=GCF_000306885.1; RF=representative genome; TAX=100901; STAX=100901; NAME=Wolbachia endosymbiont of Onchocerca ochengi; strain=wOo; AL=Complete Genome; RT=Major
Sequence
MLELAKRMSLIKLSPTIAVTDKVNRLKSQGKEICVLAAGEPDFDTPGHIKKAAIQAINEG
KTKYTAVDGTRELKGAIIDKLKRDNDLEYTPSQICVGAGAKQVLFNLLMATINPEDEAVI
PAPCWVSYVDMVSFFGGLPVMAECKENFKLTSELLRSKITEKTKWLILNSPNNPAGVVYT
YDELKKIAQILLEHPHVNIITDDIYEHIVYDGKFFTIAQVEPRLYDRVFVVNGVSKAYAM
TGWRIGYVAGRSDVVKAISILQSQSTSNPNSIAQAAAVEALNGNHDFLKERIKIFKNRRD
FVAEKLGSVPGLSVFIPQGAFYLFISCENLLGKSTKNGKVINNDLDFAEYLLEDHLVAVI
PGVAFSLKNFIRVSYATSQEQLEIGCNSIVKACEMLS
Download sequence
Identical sequences I7IAC1
gi|402496691|ref|YP_006555951.1| WP_014868919.1.68585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]