SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014893931.1.95915 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014893931.1.95915
Domain Number - Region: 288-389
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000157
Family IMD domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014893931.1.95915
Sequence length 650
Comment hypothetical protein [Mycoplasma genitalium]; AA=GCF_000292405.1; RF=na; TAX=663918; STAX=2097; NAME=Mycoplasma genitalium M2321; strain=M2321; AL=Complete Genome; RT=Major
Sequence
MKTQKISLRFKALLLSLFSAAVTITIFALPIFANNGSKTDLGLLSKNSADFLGSSKRSLA
GFDTPFSPDNLQYLEKETDYDQNFKNFTEKFKDEKITNDQLDIVDIYNLFSGFHKSVKNT
VDLMSQLQKQVEAANAIFPVDDAFVKLPKVPTELFKLVDDNVFPKLNPKGLNISDNIAAL
FERYNLKSIELKNFDLAFLRKADVIIKDRVRYNFEMQMQFQTVYVGGGNTVINLDFTLKA
QTVNFANLQDLQNTFVKVGNDLSTQLFWIPTVNKLTDNAGNDLTHIAKTVIGESFFQTNV
NLAKSVIEYDKVQPLVKQAFEERVLTPFKKEREAAKKAYEEEQRRLEEERKRQLEELRRK
EAEAKRKAEEAKRNQEKARREREAYEKSFNSFKDFKSYWLTQGKNVAKKAELIDVLKTVI
ATPAYRNKTFSLLIKGFASGVERYFNANKNDKELKKLAFGEKGIQFPRADAGIDGLYMSN
FLRHELTSKAKFSLNLKDIKVENTVEDTQLYWKDNGIHLKQANPYKFNLNIKIKYNGWYN
VHWWNWLPAKILGIPTDWSGEMNLTFVVNGDLSEIVDKHDYPGTFFQFTDKNELLFTLAV
REQIKVDNNHFMGLLKSQNLHNLQLASGATKPPVVDLASYFHFVLLTEKS
Download sequence
Identical sequences gi|402550900|ref|YP_006599620.1| WP_014893931.1.95915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]