SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014907850.1.66271 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014907850.1.66271
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily ITPase-like 7.85e-62
Family Maf-like 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014907850.1.66271
Sequence length 194
Comment MULTISPECIES: septum formation inhibitor Maf [Enterobacteriaceae]; AA=GCF_000694635.1; RF=na; TAX=1438793; STAX=573; NAME=Klebsiella pneumoniae MGH 70; strain=MGH 70; AL=Scaffold; RT=Major
Sequence
MSDLILASTSPWRRMLLEKLGLPFECAAPDVDETPRPDESARQLVTRLAQAKAQSLATRF
PNHLIIGSDQVCVLDGEITGKPHTEENARRQLRKASGSIITFYTGLALYNSASGHLQTEC
EPFDVHFRHLSDKEIEGYVRKENPLQCAGSFKSEGLGITLFERLEGRDPNTLVGLPLIAL
SQMLRRENYNPLLG
Download sequence
Identical sequences A0A181Z0R4
gi|238894121|ref|YP_002918855.1| gi|402781394|ref|YP_006636940.1| 484021.KP1_2076 WP_014907850.1.100635 WP_014907850.1.101198 WP_014907850.1.101332 WP_014907850.1.101526 WP_014907850.1.10681 WP_014907850.1.11210 WP_014907850.1.12237 WP_014907850.1.12939 WP_014907850.1.12983 WP_014907850.1.1500 WP_014907850.1.1513 WP_014907850.1.15320 WP_014907850.1.15331 WP_014907850.1.15878 WP_014907850.1.16326 WP_014907850.1.16559 WP_014907850.1.16928 WP_014907850.1.17930 WP_014907850.1.18241 WP_014907850.1.18443 WP_014907850.1.19533 WP_014907850.1.1986 WP_014907850.1.20050 WP_014907850.1.20647 WP_014907850.1.20685 WP_014907850.1.20811 WP_014907850.1.22044 WP_014907850.1.2272 WP_014907850.1.23085 WP_014907850.1.23609 WP_014907850.1.24890 WP_014907850.1.26475 WP_014907850.1.26974 WP_014907850.1.27121 WP_014907850.1.27264 WP_014907850.1.28115 WP_014907850.1.28375 WP_014907850.1.28640 WP_014907850.1.29748 WP_014907850.1.30638 WP_014907850.1.31061 WP_014907850.1.31846 WP_014907850.1.3234 WP_014907850.1.32690 WP_014907850.1.3282 WP_014907850.1.32915 WP_014907850.1.33057 WP_014907850.1.33229 WP_014907850.1.33806 WP_014907850.1.34265 WP_014907850.1.34654 WP_014907850.1.34757 WP_014907850.1.34869 WP_014907850.1.35109 WP_014907850.1.35574 WP_014907850.1.35918 WP_014907850.1.3640 WP_014907850.1.36728 WP_014907850.1.37356 WP_014907850.1.38089 WP_014907850.1.38815 WP_014907850.1.39299 WP_014907850.1.39360 WP_014907850.1.39482 WP_014907850.1.39852 WP_014907850.1.4032 WP_014907850.1.41095 WP_014907850.1.4177 WP_014907850.1.42299 WP_014907850.1.42755 WP_014907850.1.42951 WP_014907850.1.42953 WP_014907850.1.43050 WP_014907850.1.43084 WP_014907850.1.43874 WP_014907850.1.43941 WP_014907850.1.44267 WP_014907850.1.45319 WP_014907850.1.45395 WP_014907850.1.46134 WP_014907850.1.46199 WP_014907850.1.46327 WP_014907850.1.46563 WP_014907850.1.46985 WP_014907850.1.47777 WP_014907850.1.47885 WP_014907850.1.48022 WP_014907850.1.48609 WP_014907850.1.4900 WP_014907850.1.49887 WP_014907850.1.49933 WP_014907850.1.51016 WP_014907850.1.51401 WP_014907850.1.52920 WP_014907850.1.54045 WP_014907850.1.54824 WP_014907850.1.55866 WP_014907850.1.56331 WP_014907850.1.56599 WP_014907850.1.57310 WP_014907850.1.57398 WP_014907850.1.58134 WP_014907850.1.58280 WP_014907850.1.58967 WP_014907850.1.58980 WP_014907850.1.59172 WP_014907850.1.59518 WP_014907850.1.59924 WP_014907850.1.60372 WP_014907850.1.60922 WP_014907850.1.60995 WP_014907850.1.62188 WP_014907850.1.62294 WP_014907850.1.62306 WP_014907850.1.62783 WP_014907850.1.63123 WP_014907850.1.6391 WP_014907850.1.63956 WP_014907850.1.64620 WP_014907850.1.64914 WP_014907850.1.64945 WP_014907850.1.6524 WP_014907850.1.66271 WP_014907850.1.66409 WP_014907850.1.66434 WP_014907850.1.66529 WP_014907850.1.66555 WP_014907850.1.6670 WP_014907850.1.66857 WP_014907850.1.66989 WP_014907850.1.68403 WP_014907850.1.70519 WP_014907850.1.71056 WP_014907850.1.7136 WP_014907850.1.71625 WP_014907850.1.71634 WP_014907850.1.7181 WP_014907850.1.72597 WP_014907850.1.72713 WP_014907850.1.72763 WP_014907850.1.73319 WP_014907850.1.73332 WP_014907850.1.73562 WP_014907850.1.73689 WP_014907850.1.74110 WP_014907850.1.74788 WP_014907850.1.74905 WP_014907850.1.74909 WP_014907850.1.75115 WP_014907850.1.75152 WP_014907850.1.75719 WP_014907850.1.76245 WP_014907850.1.77586 WP_014907850.1.78012 WP_014907850.1.78065 WP_014907850.1.78119 WP_014907850.1.78334 WP_014907850.1.78597 WP_014907850.1.79520 WP_014907850.1.80217 WP_014907850.1.80466 WP_014907850.1.81139 WP_014907850.1.81159 WP_014907850.1.81235 WP_014907850.1.81544 WP_014907850.1.81744 WP_014907850.1.82370 WP_014907850.1.82452 WP_014907850.1.83948 WP_014907850.1.84128 WP_014907850.1.84650 WP_014907850.1.84890 WP_014907850.1.85622 WP_014907850.1.86302 WP_014907850.1.87112 WP_014907850.1.87313 WP_014907850.1.87631 WP_014907850.1.8775 WP_014907850.1.87931 WP_014907850.1.8832 WP_014907850.1.88574 WP_014907850.1.89072 WP_014907850.1.89185 WP_014907850.1.89315 WP_014907850.1.90621 WP_014907850.1.9111 WP_014907850.1.91327 WP_014907850.1.91738 WP_014907850.1.91751 WP_014907850.1.92393 WP_014907850.1.92746 WP_014907850.1.93058 WP_014907850.1.93161 WP_014907850.1.9353 WP_014907850.1.94033 WP_014907850.1.94518 WP_014907850.1.94608 WP_014907850.1.94701 WP_014907850.1.94956 WP_014907850.1.95405 WP_014907850.1.95743 WP_014907850.1.96645 WP_014907850.1.97728 WP_014907850.1.98184 WP_014907850.1.9831 WP_014907850.1.99013 WP_014907850.1.9934 WP_014907850.1.99794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]