SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014932491.1.48933 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014932491.1.48933
Domain Number 1 Region: 11-146
Classification Level Classification E-value
Superfamily CheY-like 4.98e-25
Family CheY-related 0.0016
Further Details:      
 
Domain Number 2 Region: 179-385
Classification Level Classification E-value
Superfamily PP2C-like 0.000000955
Family PP2C-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014932491.1.48933
Sequence length 388
Comment stage II sporulation protein E [Brachyspira pilosicoli]; AA=GCF_000296575.1; RF=na; TAX=1133568; STAX=52584; NAME=Brachyspira pilosicoli B2904; strain=B2904; AL=Complete Genome; RT=Major
Sequence
MASTRNNILTEKVLIVDTNIDYAKFIQKFLKKNNYLCYIALSYEEAINMTYEKIPDCILV
DYMLPNAGACRLAGYIKSDNLLKNIAVLFLTASDNKTESLKAFDCGADGFFEKSIDTDLF
LSKMKSYIRLKKAIESNMMYMDILKRDIEYAAKLQKTILSYGNTSIPKNEISIHHYAPNE
VSGDYSGIKLINDGYYAILLADVSGHGVAASMLTILIKSFFDSHAIIDDKNTSPAIFLEK
LNKFFIEEGFDKNLFACVFYALYNNDTGALLCSSAGSPKPIYYSNGKDEICTVDIDGPLI
GMIDDSEYTEMEIQLNRNDILFVFTDGAYEVFDDNNNMFGDEHLKQIFSKNVKNNVSDIK
EKIINEIKSFTKEPLKDDVSMILLKRTT
Download sequence
Identical sequences J9UXI8 K0JGT3
gi|431807884|ref|YP_007234782.1| gi|404476915|ref|YP_006708346.1| gi|434381359|ref|YP_006703142.1| WP_014932491.1.48933 WP_014932491.1.67631 WP_014932491.1.92922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]