SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014941710.1.95202 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014941710.1.95202
Domain Number 1 Region: 13-96
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000182
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014941710.1.95202
Sequence length 105
Comment MULTISPECIES: STAS domain-containing protein [Mycobacterium]; AA=GCF_000767485.1; RF=na; TAX=1299331; STAX=1767; NAME=Mycobacterium intracellulare 1956; strain=1956; AL=Complete Genome; RT=Major
Sequence
MTTPLTLDTARGRDGKLVLVASGEIDLTNVDAFTLALSTAATGSDGAVLVDLSAVEYLDS
AAINALAAHADRIELVAHPILMPVLKVSGLTELTAIVTAPPTEKR
Download sequence
Identical sequences A0A081HYY1 J9WFC1
WP_014941710.1.11749 WP_014941710.1.13459 WP_014941710.1.15143 WP_014941710.1.39679 WP_014941710.1.95202 gi|406030199|ref|YP_006729090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]