SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014948094.1.56939 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014948094.1.56939
Domain Number 1 Region: 90-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-66
Family RecA protein-like (ATPase-domain) 0.00000000387
Further Details:      
 
Domain Number 2 Region: 48-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.71e-29
Family Cold shock DNA-binding domain-like 0.0000138
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000000000392
Family Rho termination factor, N-terminal domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014948094.1.56939
Sequence length 421
Comment MULTISPECIES: transcription termination factor Rho [Alteromonas]; AA=GCF_000808635.1; RF=na; TAX=28108; STAX=28108; NAME=Alteromonas macleodii; strain=AD037; AL=Contig; RT=Major
Sequence
MNLTELKNKPISELVNLAEEMGLENMARARKQDIIFSILKTHAKSGEDIFGDGVLEILQD
GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIAGKIRPPKDSERYFALLKIREVN
FDKPENSRNKILFENLTPLHAADRLRMERGNGSTEDITARVLDLASPIGKGQRGLIVAPP
KAGKTLLLQNIAQSIAANHPDCELMVLLIDERPEEVTEMHRLVQGEVVASTFDEPASRHV
QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDANALHKPKRF
FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLNRKIAEKRVFPAIDF
NRSGTRREELLTAQDELQKMWILRKIVHEMSEIDAMDFLISKLSMTKTNDEFFDAMRRQK
S
Download sequence
Identical sequences A0A0B3XW27 A0A0E0YBU9 A0A126PVT0 A0A2E1R495 K0EBF6
gi|407686251|ref|YP_006801424.1| gi|406595397|ref|YP_006746527.1| WP_014948094.1.13129 WP_014948094.1.19844 WP_014948094.1.2564 WP_014948094.1.28082 WP_014948094.1.29778 WP_014948094.1.31699 WP_014948094.1.31748 WP_014948094.1.49223 WP_014948094.1.56939 WP_014948094.1.65302 WP_014948094.1.81038 WP_014948094.1.85883 WP_014948094.1.95341 WP_014948094.1.96346 gi|407682330|ref|YP_006797504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]