SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014966043.1.40567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014966043.1.40567
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily GlnB-like 2.73e-16
Family Prokaryotic signal transducing protein 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014966043.1.40567
Sequence length 109
Comment MULTISPECIES: nitrogen regulatory protein P-II [Nitrosopumilus]; AA=GCF_000299395.1; RF=na; TAX=1229909; STAX=1229909; NAME=Candidatus Nitrosopumilus sediminis; strain=AR2; AL=Complete Genome; RT=Major
Sequence
MLKIEVILGENDVMAISEGLKAVGIGGLTVSKVRGRGKKPGPEIHASKGSEIFVPQFNDK
YRLEVIISDTKEDEVVSIIKENARVGKIFISQILRAIDISTDAEGEKTI
Download sequence
Identical sequences K0BDY9
WP_014966043.1.40567 WP_014966043.1.82955 gi|407465739|ref|YP_006776621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]