SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014982751.1.73442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014982751.1.73442
Domain Number 1 Region: 188-322
Classification Level Classification E-value
Superfamily CBS-domain pair 3.54e-33
Family CBS-domain pair 0.0023
Further Details:      
 
Domain Number 2 Region: 330-395
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 8.18e-16
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014982751.1.73442
Sequence length 453
Comment membrane protein [Nocardia brasiliensis]; AA=GCF_001689765.1; RF=na; TAX=37326; STAX=37326; NAME=Nocardia brasiliensis; strain=HUJEG-1; AL=Contig; RT=Major
Sequence
MNSLTLILLAVLLVPVGGVFAGVDSALNTISPARVDDMVRADRPGAVRLSRIVADRARYV
NLMVLLRILCEIGATVLLAAGLLAVWADDWALLVTAIVMVLVSYVVIGVGPRTLGRQHAY
SIALASALPLQFIGALLGPLSRLLILLGNAITPGKGFRNGPFASEIELREVVEMASERGV
VADDERRMIQSVFELGDTAARAVMVPRTEMVWIEADKTAAQAMSLAVRSGHSRIPVIGEN
VDDILGVVYLKDLVPYAERGRKVLVREVMRPAVFMPDSKPLDSLLDEMQRRRNHMALLVD
EYGGIAGLVTIEDVLEEIVGEIADEYDTDETPPIEDLGDGRYRVSARLPVEDLGELYGLD
IEDEDVDTVGGLLAHELGRVPLPGSKVEVHGLVLRGEGGADTRGRVRVHTVVVRKATDKS
QNADGDEKSNGKRKGNGSDRDNPAGRHEDGDSE
Download sequence
Identical sequences K0EWD6
WP_014982751.1.58666 WP_014982751.1.73442 gi|407643111|ref|YP_006806870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]