SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014987927.1.58666 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014987927.1.58666
Domain Number 1 Region: 34-296
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-23
Family Phosphate binding protein-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014987927.1.58666
Sequence length 297
Comment transporter [Nocardia brasiliensis]; AA=GCF_000250675.2; RF=representative genome; TAX=1133849; STAX=37326; NAME=Nocardia brasiliensis ATCC 700358; strain=HUJEG-1; AL=Complete Genome; RT=Major
Sequence
MMLAASLRMLARIVLVATAVTAVSCGNDDQGARITVGAGDAVESVMLAEIYAGALARTGA
RTTVATGSGERADYLAALDAGRITLLGEHSGALLTHLDAHAPERTPKNVADALSKSLPEG
LVVSDIADGTDLRARVLLTTEAATHDAVQSVRDLGPSCGTRTAGVAPAAGLLTAPPAANT
VTGCAFAATIPFPDLAALRKALLDGQIQAGLLLGPPAAGTGSTDGLTILSDDDYAVRAEN
VLPLFRKGTLDQAQIKKLNYVAGELTTEELAELIRRVRDEHRDPGDVARAWLDDHAL
Download sequence
Identical sequences K0F5R4
gi|407648292|ref|YP_006812051.1| WP_014987927.1.58666 WP_014987927.1.73442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]