SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015042659.1.88763 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015042659.1.88763
Domain Number 1 Region: 11-86,171-345
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.22e-55
Family Bacterial dinuclear zinc exopeptidases 0.0000611
Further Details:      
 
Domain Number 2 Region: 76-179
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 8.24e-18
Family Aminopeptidase/glucanase lid domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015042659.1.88763
Sequence length 350
Comment MULTISPECIES: Cellulase M-related protein [Dehalobacter]; AA=GCF_000445165.1; RF=na; TAX=1339256; STAX=1339256; NAME=Dehalobacter sp. UNSWDHB; strain=UNSWDHB; AL=Scaffold; RT=Major
Sequence
MLRNSFELARELTCSLTEMTGVSGYEQGLKTTLQDIFVPLSTETFSDFIGNFYAVKKGEH
SGKHSVMLAAHIDEIGLMITHIDERGFLHFVTLGGIDQRTLLYQEILVHGKEELRGVVCL
GSSHKDSKKQQTLDIEDLVIDIGFNDAAAVQMVKPGDIASIKRCPLHLLNDRISGKALDD
RAGVAVLAVCLNELMGMKHQHDVVAVATVQEEVGLRGGLTSSERLLPSLAVAVDVTHAQT
LDTKSQVSAELAKGPVISLGPNIHPWVYARLSDSAQQNRIACQRQAVPGATGTDARVIQL
TGYGIPTGLVSIPLRYMHTSVETASLQDIVECGKLLAYFIASLPEELEEL
Download sequence
Identical sequences K4LDS2 T0I870
gi|410657231|ref|YP_006909602.1| gi|410660267|ref|YP_006912638.1| WP_015042659.1.6016 WP_015042659.1.71633 WP_015042659.1.88763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]