SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015044024.1.88763 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015044024.1.88763
Domain Number 1 Region: 209-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.75e-69
Family B3/B4 domain of PheRS, PheT 0.00000604
Further Details:      
 
Domain Number 2 Region: 472-695
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.58e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00013
Further Details:      
 
Domain Number 3 Region: 36-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.46e-37
Family Myf domain 0.0022
Further Details:      
 
Domain Number 4 Region: 705-802
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.31e-29
Family Anticodon-binding domain of PheRS 0.00025
Further Details:      
 
Domain Number 5 Region: 409-480
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.92e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015044024.1.88763
Sequence length 803
Comment MULTISPECIES: phenylalanine--tRNA ligase subunit beta [Dehalobacter]; AA=GCF_000445165.1; RF=na; TAX=1339256; STAX=1339256; NAME=Dehalobacter sp. UNSWDHB; strain=UNSWDHB; AL=Scaffold; RT=Major
Sequence
MRVSMEWLKQYLELRLSPEELAEVLTGGGIEVEGVECLNKGFAEVYIGEILDIQPHPDAQ
KLQVCRLNTGREVLTIVTGASNVLVGDKVPVAVPGAVLPGGKEIQPVDMRGVKSYGMLCS
DKELEIEAVGQERSKGGILILSPDAPVGESLETYLGLQDSVLELELYPNRPDCLAMVNVA
REAGTLLGKKPVLPEWAREEMPSWPEDVRQKVEIEDPELSWRYSALLVDDVVIQPSPLWM
QNRLRAAGVRPINNIVDITNYCMLEMGQPLHAFDRDKLQGTVRVRKARQGETMVSLDGIE
RRLEPDMLVIADDNGPQAIAGVMGGLESEVTGKTCRILFESAHFLGSSVRRTSRKLGLRS
ESSSRFEKGVNPYWTVPTLGRVAELLLELEAGVPMSFTEKVCALPPKVRIEIAVSTVNQV
LGVEYTDQEIEKVFEALDFEYLKLPDCRYSVEIPSYRQDLKIEVDLIEEIARIIGYDKIP
TTLPQGSQTQGCRTPEQVFRRKLRKILIKAGMNEVISYSFSNKEMDDQWGSEGRNIPLLN
PLREELGTMRTSLLPGLLEIASRNTARRNTDLLLFEIGNVYLPKELPLKKLPDEVSRIAG
LAQGESKRHWLNSQVKFDFFYVKGILTQIAEECGMEFEYRRIEEGKYCSLLHPGRSASIY
SKGEYLGILGEIYPQLDQKWDLQCPVLFELDFGVLSRNANLTVVAKSYPRYPAIQRDLAV
VVPEEVSAEDIKKKVMALGGEFLKEVELFDVYQGQPVPAGHKSLAFTMRYQSAERTLKDE
EVNAFNSDILSGIQQEFGAKWRK
Download sequence
Identical sequences K4LH81 T0HUS2
WP_015044024.1.6016 WP_015044024.1.71633 WP_015044024.1.88763 gi|410658614|ref|YP_006910985.1| gi|410661602|ref|YP_006913973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]