SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015044506.1.71633 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015044506.1.71633
Domain Number - Region: 31-85
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.0366
Family YmcA-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015044506.1.71633
Sequence length 108
Comment MULTISPECIES: hypothetical protein [Dehalobacter]; AA=GCF_000305815.1; RF=na; TAX=1131462; STAX=1131462; NAME=Dehalobacter sp. CF; strain=CF; AL=Complete Genome; RT=Major
Sequence
MISLDEALVIYTDKITSGQDIDYNYFYENLAQDDIEEFKELSKIINMTISVPYTQEFDAV
FKKINDYKEQLYSLPQAADFRKDRKDSDGNDDAQRIIDELFNEEFSDE
Download sequence
Identical sequences K4L4L7
gi|410659103|ref|YP_006911474.1| gi|410662089|ref|YP_006914460.1| WP_015044506.1.6016 WP_015044506.1.71633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]