SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015044689.1.88763 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015044689.1.88763
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily YheA/YmcA-like 3.14e-20
Family YmcA-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015044689.1.88763
Sequence length 168
Comment MULTISPECIES: hypothetical protein [Dehalobacter]; AA=GCF_000445165.1; RF=na; TAX=1339256; STAX=1339256; NAME=Dehalobacter sp. UNSWDHB; strain=UNSWDHB; AL=Scaffold; RT=Major
Sequence
MEYIVKARELGEALLQTPEVQRLKEAEAEIQNDPEAAKAFAAYQDKERQILTAQMFSKVV
SEKDTLALIDLKMRLIKLYPSIRSFFSIQQDLEKIMATVNLTITTTIYGMPSAEQLPFPK
EIQNLAQQLLDTIGGDKNGPAMTIPEGFRIPEGLNVSELLSRLNPKSK
Download sequence
Identical sequences K4L5Z4 T0HV36
gi|410659289|ref|YP_006911660.1| WP_015044689.1.6016 WP_015044689.1.71633 WP_015044689.1.88763 gi|410662276|ref|YP_006914647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]