SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015053266.1.66729 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015053266.1.66729
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily GlnB-like 6.35e-34
Family Prokaryotic signal transducing protein 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015053266.1.66729
Sequence length 105
Comment nitrogen fixation nifHD region glnB 1 [Methanolobus psychrophilus]; AA=GCF_000306725.1; RF=representative genome; TAX=1094980; STAX=420950; NAME=Methanolobus psychrophilus R15; strain=R15; AL=Complete Genome; RT=Major
Sequence
MQMIRAIIRPNKVSYVVEELEKEGFVSLTKIDVFGRGKQRGIHTAEVHFDELPKTMIMMV
VDDENQDKVVEIIKRSAHTGKYGDGKIFINPIESSYTIRTGEAGI
Download sequence
Identical sequences K4MBZ2
gi|410670547|ref|YP_006922918.1| WP_015053266.1.66729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]