SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015115322.1.60169 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015115322.1.60169
Domain Number 1 Region: 1-31
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.0000000000196
Family Subunit XII of photosystem I reaction centre, PsaM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015115322.1.60169
Sequence length 31
Comment photosystem I reaction center subunit XII [Nostoc sp. PCC 7107]; AA=GCF_000316625.1; RF=na; TAX=317936; STAX=317936; NAME=Nostoc sp. PCC 7107; strain=PCC 7107; AL=Complete Genome; RT=Major
Sequence
MPISDTQVYIALVVALVPGLLAWRLATELYK
Download sequence
Identical sequences A0A1Z4GFW3 K9QJ59
gi|427709902|ref|YP_007052279.1| WP_015115322.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]