SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015118441.1.44015 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015118441.1.44015
Domain Number - Region: 25-113
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0314
Family Clc chloride channel 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015118441.1.44015
Sequence length 258
Comment TIGR03943 family protein [Rivularia sp. PCC 7116]; AA=GCF_000316665.1; RF=na; TAX=373994; STAX=373994; NAME=Rivularia sp. PCC 7116; strain=PCC 7116; AL=Complete Genome; RT=Major
Sequence
MSSKTKRPSKRLQKLLPWLDFLAITAWGFLLLKYWLSQELYLLIHPNYFALVVIAGIVLI
AIGIAKAIQLVRQRKAPPEVQHLNLIPPRFGSLLLVFVAILGFAIAPQVFASDKAIQRGI
ADLGQVNSRLQPQSFRTSVRPEERSLVDWTRTLSVYPEPDAYTGQKAKVKGFVIYPPDLG
DEYFFLARFVLTCCAADAYPVGLPVKLKNGQTRELFKKDSWLEVEGEMATEILSGKRRLT
ILSNSIKKVSQPKNPYSY
Download sequence
Identical sequences K9RBR9
gi|427735869|ref|YP_007055413.1| WP_015118441.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]