SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015118932.1.44015 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015118932.1.44015
Domain Number 1 Region: 73-142
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000234
Family Barwin 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015118932.1.44015
Sequence length 146
Comment septal ring lytic transglycosylase RlpA family lipoprotein [Rivularia sp. PCC 7116]; AA=GCF_000316665.1; RF=na; TAX=373994; STAX=373994; NAME=Rivularia sp. PCC 7116; strain=PCC 7116; AL=Complete Genome; RT=Major
Sequence
MNQKRILLAFLGTVLGICFTASSFSQQAAFAYSESEESNVVERVENNQSLLIARRRKRRR
KARKCSSQIASYYGSNTKLTAAHKTLPFGTRVKVTNKRNGRSVIVRINDRGPFIRCRVID
VSRKAARELGMIRSGVAPVTLKVLGK
Download sequence
Identical sequences K9RD22
WP_015118932.1.44015 gi|427736366|ref|YP_007055910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]