SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015124569.1.5248 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015124569.1.5248
Domain Number 1 Region: 16-225
Classification Level Classification E-value
Superfamily Ribosomal protein L1 6.67e-75
Family Ribosomal protein L1 0.000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015124569.1.5248
Sequence length 236
Comment 50S ribosomal protein L1 [Synechococcus sp. PCC 6312]; AA=GCF_000316685.1; RF=na; TAX=195253; STAX=195253; NAME=Synechococcus sp. PCC 6312; strain=PCC 6312; AL=Complete Genome; RT=Major
Sequence
MAKVSKRLRELQAKVEDRPYAPLDALNLLKETATAKFPESAEAHIRLGIDPKYTDQQLRT
TVALPKGTGQTVRVAVIARGEKVNEATQAGADIAGSEELIDEIQKGMMDFDLLIATPDMM
PQVAKVGRILGPRGLMPSPKAGTVTFDLPQAISEFKAGKLEFRADRTGIVHVLFGKASFP
AEDLLVNLKALQETIDRNRPSGAKGRFWRSIYVAATMGPSIQVDISGLRDLKFGEV
Download sequence
Identical sequences K9RU18
gi|427712945|ref|YP_007061569.1| WP_015124569.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]