SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015129060.1.42896 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015129060.1.42896
Domain Number 1 Region: 215-285
Classification Level Classification E-value
Superfamily PCD-like 9.68e-20
Family PCD-like 0.00063
Further Details:      
 
Domain Number 2 Region: 6-130
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000017
Family Toll/Interleukin receptor TIR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015129060.1.42896
Sequence length 295
Comment transcriptional coactivator/pterin dehydratase [Calothrix sp. PCC 7507]; AA=GCF_000316575.1; RF=na; TAX=99598; STAX=99598; NAME=Calothrix sp. PCC 7507; strain=PCC 7507; AL=Complete Genome; RT=Major
Sequence
MLNAPIFISYRRIDSAAEAGRLYSTILQELGRDTVFMDTSSIELGTQWPKELEEALQKAQ
IVIVVIGTKWIRISDEYGLRRIDQEDDWVRREIEFALRENKKLLPLLVRGAKMPPANKLP
TSISGLTQRQAVDIRHDYWDHDIKLALEQLRLVTDKNKQSERSLTSNNLWGIYPTPDPEK
PEPISDEKLQIALSGNLSKWEKVVSPLPEDPTRVRVEIWRKYQFKTFRDAIDFMNQVAPG
CDIALHHPRWENVWKTVRVYLTSWDIGHQISDRDIQLAKYFDKAFSDFPGAKQDR
Download sequence
Identical sequences K9PKC2
WP_015129060.1.42896 gi|427718089|ref|YP_007066083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]