SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015131138.1.42896 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015131138.1.42896
Domain Number 1 Region: 51-134
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000785
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Weak hits

Sequence:  WP_015131138.1.42896
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00167
Family Rubredoxin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015131138.1.42896
Sequence length 137
Comment hypothetical protein [Calothrix sp. PCC 7507]; AA=GCF_000316575.1; RF=na; TAX=99598; STAX=99598; NAME=Calothrix sp. PCC 7507; strain=PCC 7507; AL=Complete Genome; RT=Major
Sequence
MKCPVCGAVYRPTKGSRETGKDEELVSISTSSPSPTCRRCKADLSDLFHIHDHAIWYHRQ
ALHLLSQKLYPEAATYNNQALVLYYSNADFHTLAGKLSALQGEWREAILSWQQALKFDPQ
NAIASNCLQMIELMTRN
Download sequence
Identical sequences K9PPM2
gi|427720185|ref|YP_007068179.1| WP_015131138.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]