SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015132156.1.42896 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015132156.1.42896
Domain Number 1 Region: 297-412,450-558
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.46e-37
Family ABC transporter ATPase domain-like 0.00027
Further Details:      
 
Domain Number 2 Region: 56-284
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 9.68e-21
Family DNA repair protein MutS, domain III 0.017
Further Details:      
 
Domain Number 3 Region: 754-825
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000144
Family Smr domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015132156.1.42896
Sequence length 828
Comment endonuclease MutS2 [Calothrix sp. PCC 7507]; AA=GCF_000316575.1; RF=na; TAX=99598; STAX=99598; NAME=Calothrix sp. PCC 7507; strain=PCC 7507; AL=Complete Genome; RT=Major
Sequence
MIQSETLELLEWHRLCQHLSTFAATKLGAIASRHLQIPDSQAESIQLLEQTKEVYQLENR
LTTSLSFDGIQDIGDALERAELQGILTGDELLAIATTLAGARNLRRVIDNQLDCPILTAL
VAELRTYPELEQEIHRCIDERGQVTDRASQKLGEIRTDLRRLRSQITQKLQNILQAKSGA
VQEQLITQRGDRFVIPVKAPQKDAIPGIVHDTSTSGATLYVEPNSIVPMGNQLRQVIRKE
QAEEEAIRRALTEQVAAVKPDLERLLAIVTTLDLATARARYSFWLGANPPRFIHRQDQEI
ITLRHLRHPLLVWQQQHEQGQPVVPVDLLISPHIRVVTITGPNTGGKTVTLKTLGLAALM
AKVGLFIPAREPVEIPWFDQVLADIGDEQSLQQSLSTFSGHIRRISRILNALGHGEEAAL
RLRSGQGSREQGAGEQNLELRTPDSVLSTQHSALVLLDEVGAGTDPVEGSALAIALLQYL
ADHAQLAIATTHFGELKALKYEDERFENASVEFDETTLSPTYRLLWGIPGRSNALTIALR
LGLKPEVIEHAKTQVGEATDEVNQVIAGLEAQRRRQETKATEAQNVLQQAERLYKEVSAK
AEALQEREKALRASQEVAVQQAIAQAKTEIAQVIRRLQQGTPTAQDAQQATNALNQIAQQ
YQPAPPPKPKAGFMPKVGDRIRISKFGQTAEVLTAPDEDGEFSVRFGIMKMTVTLEDIES
LDGQKAEPVVKQKPAPAPVPQPAQPALAIRTSKNTIDLRGKRVADAEFMLDKAISEASGP
VWIIHGHGTGKLRQGVHTYLQQHPRVNNYEAAAQVDGGSGVTVAYVQD
Download sequence
Identical sequences K9PV37
gi|427721207|ref|YP_007069201.1| WP_015132156.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]