SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015164361.1.5078 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015164361.1.5078
Domain Number 1 Region: 5-181
Classification Level Classification E-value
Superfamily RL5-like 4.94e-73
Family Ribosomal protein L5 0.000000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015164361.1.5078
Sequence length 181
Comment 50S ribosomal protein L5 [Pseudanabaena sp. PCC 7367]; AA=GCF_000317065.1; RF=na; TAX=82654; STAX=82654; NAME=Pseudanabaena sp. PCC 7367; strain=PCC 7367; AL=Complete Genome; RT=Major
Sequence
MAKQRFLESYQTQAVPKLIEQFKYTNSHQVPKFNKVVVNRGLGEASQNAKALESSITEIS
VITGQKPVVTRARKAIAGFKLREGMPVGVMVTLRRERMYAFLDRLINFSLPRIRDFRGIS
AKSFDGRGNYTLGVREQLIFPEISYDSIDQIRGMDISIITTANTDEEGRALLAAMGMPFR
K
Download sequence
Identical sequences K9SGR3
gi|428217351|ref|YP_007101816.1| WP_015164361.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]