SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015165255.1.5078 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015165255.1.5078
Domain Number 1 Region: 20-183
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.91e-44
Family Pentapeptide repeats 0.0000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015165255.1.5078
Sequence length 191
Comment pentapeptide repeat-containing protein [Pseudanabaena sp. PCC 7367]; AA=GCF_000317065.1; RF=na; TAX=82654; STAX=82654; NAME=Pseudanabaena sp. PCC 7367; strain=PCC 7367; AL=Complete Genome; RT=Major
Sequence
MAIDKQVELLKQSVANWNNVRNNGSLQNLDLCGANLRGAKLAGANLSKVDLSGSDLIGTD
LSRGNLSSCDLSAACLRGANLKEANLANADLSSADLRGASLNRASLCKADLSAADLGVAE
LINADLSEANFKGADLRGANFTGAIFHKTDLRGSDLHEAILTDADLAGADFRGAIMPDGN
IYQMRPNTTEV
Download sequence
Identical sequences K9SKJ7
gi|428218257|ref|YP_007102722.1| WP_015165255.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]