SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015168899.1.58188 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015168899.1.58188
Domain Number 1 Region: 11-460
Classification Level Classification E-value
Superfamily L-aspartase-like 1.57e-145
Family L-aspartase/fumarase 0.00000000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015168899.1.58188
Sequence length 461
Comment argininosuccinate lyase [Synechococcus sp. PCC 7502]; AA=GCF_000317085.1; RF=na; TAX=1173263; STAX=1173263; NAME=Synechococcus sp. PCC 7502; strain=PCC 7502; AL=Complete Genome; RT=Major
Sequence
MTNTPQPWSQRFETALHPAIARFNASISFDIALIEYDITGSQAHAKMLGQVGIISESEAE
AIVTGLEQIRQAYRSGEFIPGVEAEDVHFAVEKRLTELIGDTGKKLHTARSRNDQVATDV
RLYLREQINLIKSDLRNWQAAIVTQAEQNIDTLIPGYTHLQRAQPVSLAHHLLAYFEMAQ
RDYQRLGEIYNRVNVCPLGSGALAGTPHPINRALSAEYLNFGAVGNNSLDGVSDRDFAVE
FLNAASLIMVHLSRFSEEIILWSSQEFSFIGLSDRISTGSSIMPQKKNPDVPELVRGKTG
RVFGHLQGMLTLLKGLPLAYNKDMQEDKEAIFDTVTTVRVCLEAMTILLTEGITFKKDRL
AQAVTEDFSNATDVADYLATKGVPFREAYNLVGKLVKTCTSEGILLKDLSLAQWQEFHPK
FESDIVEAIAPTQVVNVRNSYGGTGFEQVKLQVATAKTVIS
Download sequence
Identical sequences K9SUD7
gi|428222207|ref|YP_007106377.1| WP_015168899.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]