SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015173523.1.54702 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015173523.1.54702
Domain Number 1 Region: 380-632
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.21e-42
Family Nitrogenase iron protein-like 0.00000168
Further Details:      
 
Domain Number 2 Region: 329-406
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.00000000000000164
Family Domain of the SRP/SRP receptor G-proteins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015173523.1.54702
Sequence length 635
Comment signal recognition particle-docking protein FtsY [Geitlerinema sp. PCC 7407]; AA=GCF_000317045.1; RF=na; TAX=1173025; STAX=1173025; NAME=Geitlerinema sp. PCC 7407; strain=PCC 7407; AL=Complete Genome; RT=Major
Sequence
MVFNWFRRQFSRPEEAQEQQPTQEEAPEVAEESAAEGEESGEAQAADDYLEWAKAAYQNI
KKQQETQEPDELEEPAAPEEPVAEAEPEPIPEPEPEAEPEPEVAEPEPEVAAPEVAEPAI
AELAVAEPEVPEPEPEVIEPEEAEPVAAAEVPAPEAEPETVAAETAPEAIAPPEPETERP
EAEAAEPEVPEPEPVAEAAEPAAPEEAEPEAVEPEPPVVAASAAEPAAPAIAEEPPTPEA
EAPADAPEEVVEAAPLPFWAQAEADRQERMERLRATAMEEPEPEVSTPSSAATEEFVLPI
DFDEGFLWSAEILAAQGRRPDQVSIEEITWLKRLRQGLDKTRRGLINQLKAIVGQGPLNQ
DAVLEIEALLLQADVGYEATDHIITALQSKLREETLPPEEAIAYLKQILRELLDTPLNNT
ANYAFAPEPDTLNIWLMTGVNGAGKTTTIGKLAHLASKSDYKCLIAAADTFRAAAVQQVK
VWGDRSSVEVIANPGKNTDPAAVVYDAIAAAQSRDIELLLVDTAGRLQNKKNLMEELAKI
RRIVDKKAPDAKIESLLVLDATLGQNGLRQAEVFAEAAQLSGVVLTKLDGTAKGGIALAV
VQQLGLPIRFIGAGEGIEDLRPFSSYEFVEALLNG
Download sequence
Identical sequences K9SDU3
gi|428226914|ref|YP_007111011.1| WP_015173523.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]