SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015180661.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015180661.1.75295
Domain Number 1 Region: 380-426
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000000034
Family GSPII protein E N-terminal domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 314-360
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000126
Family GSPII protein E N-terminal domain-like 0.024
Further Details:      
 
Weak hits

Sequence:  WP_015180661.1.75295
Domain Number - Region: 116-205
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00365
Family Tyrosine-dependent oxidoreductases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015180661.1.75295
Sequence length 450
Comment WecB/TagA/CpsF family exopolysaccharide biosynthesis protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MTTTTVRPADFSADFSEVERLPNLSVHLLSRRITCMPVASIVEAINSACIQGRKITVANY
NVHSFNLSMLLPWFYNFLQSAEITHCDSTGILKALEFMGLKLPLEYRASYTALMPALLEH
CNKQGFSIFLLGSKPECLEAAIDQLKSEYPNIRVDGHHGYFDIEDLDQNEAVIQKINIAK
PNILVVGMGMPRQENWIRLHRSRLNVNVIMAGGAVIDRLAGIVSDCPSFLSEWGLEWFYR
LCREPKRLAVRYLLGNPAFVLLLALAKFYASPLEVEDIPFNSTSTLKLQKYRPNSSSTLK
NQNRFLAIVHPDDRHLGRYLVEAGLLTPLQLKTALSEQQVTGLRLSELIVRKRWLKQQTV
EFLMEKLLLREHAVVQTDDKRLGHYLVEAGLLTQAQVETALSEQKGTGQRLGEVIVRKGW
IQEQTVEFLIKQVILSERALFTRALAYKQG
Download sequence
Identical sequences K9WAG6
gi|428308926|ref|YP_007119903.1| WP_015180661.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]