SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015180662.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015180662.1.75295
Domain Number - Region: 88-162
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000115
Family Collagen-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015180662.1.75295
Sequence length 165
Comment hypothetical protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MSIVRSNPMSTAVSFRLILGFLLLNVVQIAESTPTRAQPLTVKISKEDSTVSEPTTFKST
LIIAQQSRTRRIRFARGASSALVEDAVVRGTRDIYRLGAKAGQKMTVSITSVENNAVFDI
ISPKQKLLKQEATSWTTQLPATGDYSIVVGGTRGNATYKLRVEIK
Download sequence
Identical sequences K9W8D8
WP_015180662.1.75295 gi|428308927|ref|YP_007119904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]