SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015182350.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015182350.1.75295
Domain Number 1 Region: 206-402
Classification Level Classification E-value
Superfamily PheT/TilS domain 9.68e-66
Family B3/B4 domain of PheRS, PheT 0.0000046
Further Details:      
 
Domain Number 2 Region: 491-704
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.03e-45
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00012
Further Details:      
 
Domain Number 3 Region: 36-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.08e-43
Family Myf domain 0.0025
Further Details:      
 
Domain Number 4 Region: 715-814
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.83e-30
Family Anticodon-binding domain of PheRS 0.00062
Further Details:      
 
Domain Number 5 Region: 415-498
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000054
Family Domains B1 and B5 of PheRS-beta, PheT 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015182350.1.75295
Sequence length 815
Comment phenylalanine--tRNA ligase subunit beta [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MRISLNWLRELVDVTLAPEELAETLTFAGFEVEDIEDLRKLADGVVVGKVLDVQPHPNAD
KLRVCQVDIGDPNGPLNIVCGAANVRAEAYVPVATSGTYLPAIDLKIRASKLRGVRSEGM
ICSLAEVGLEKQAEGIHIFEEENLQLGSDVRPLLHLEDVILDLTATANRADALSMVGVAR
EVAALTGAVLKLPQAPELSLPSGAKGLHLKISEPGACPAYMGTVIEGVKIEPSPDWLQRR
LQAAGVRPINNVVDVTNYVLLEWGQPLHAFDRDRLLAVTGNNSLTIGVRLATQGESLKTL
DGQTRTLQPQTLLITANDKPVALAGVMGGEETEVYEGTQNIVLEAALFESVAIRRSARSL
GLRTEASTRFERGVNQAELGIATKRAIALLTELASGTLTSQSVADTRPDPATWTRSIELR
LDRINQILGPVELEDEIGEIMPEDVERILTALGCQLQRGKDEESLQWTVTVPPYRYRDLE
REIDLIEEVARLYGYNNFCEELPDKTEAGYLSLEQQLMRQLREAFRAAGLTELVQYSLVK
PTKDKQINLANPLFTEYSALRTDLLSGLIDACQYNWEQGNGVLNGFEIGRVFWREEEGFQ
EADAVAGILGGDPTQGRWVQGGQESPMSWYEAKGVLESVFERLALKIEYQPNRQDNRFHP
GRTASLWLQGESLGRFGQLHPQLRSEYGLPDSIYAFELDLDVLLDALAQEASLTPRFKPY
PTFPASDRDIAFFVAEKVSVADIERTTLNAGKPLLESVQVFDEYRGESVPKGQRSLAFRL
VYRAGDRTLVAEEVESLHQKVRESLVEKFGVTLRV
Download sequence
Identical sequences K9WEH5
WP_015182350.1.75295 gi|428310630|ref|YP_007121607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]