SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015184161.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015184161.1.75295
Domain Number 1 Region: 161-345
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-59
Family Methylesterase CheB, C-terminal domain 0.0000122
Further Details:      
 
Domain Number 2 Region: 3-108
Classification Level Classification E-value
Superfamily CheY-like 5.69e-27
Family CheY-related 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015184161.1.75295
Sequence length 360
Comment chemotaxis response regulator protein-glutamate methylesterase [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MSIRVLLVEDSPITLVILKRILNSSPEIEVVGEARTGLEALQLIPQVQPDVICTDLHMPH
MDGLEFTSEVMALYPRPILVISSWVQEEDALHVFQLLEAGALDIFPKPAAGLSTENQLIN
QELINKIQILSGVKVFKKKRKSPSPVKSLDNFSFQPYVKPEIVVIGASTGGPQAINELFT
QLPSNLSVPVICVQHICVGFLQGFLDWLSSSCRLPIQIAKPGTIPKPGTIYFPPEQQHLE
LDKQGRFICSNSQPLDGHRPSVTVTFKSVSKFYGRATVGILLTGMGKDGAEGMHSIAKAG
GLTIAQDEATSVIFGMPKEAIDLGAAQLVLPIHAIAPKLLDILHQQSLLSGKQIGIYKIC
Download sequence
Identical sequences K9WHZ2
gi|428312454|ref|YP_007123431.1| WP_015184161.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]