SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015185247.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015185247.1.75295
Domain Number - Region: 117-154
Classification Level Classification E-value
Superfamily PKD domain 0.0388
Family PKD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015185247.1.75295
Sequence length 342
Comment S-layer protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MTNVPPPDPDSSRLGFDELLGIVIAFATIGTILAVTLGQRDKGFNLSRLLNPEARAPTAS
PSGVIPLPQQTPVPTVSPEATLLPGQEDIAPSPSPTSITRRLAAPVPTAQPVPAEAPQAG
STTIPIIVPAPLAEASPTPTPVAAATPIKFTDVPQDLWARPYIEALASRGIVSGFPDGTF
KPGGAITRAEFAALLQKAFEQQPTSTALNYKDVPTSHWALPAIDQSVKTGFFRGYPNNIF
RPNQPISKVQTIVALASGLGLKPTTVEQDVLKTYEDSNRIPNYAKAPVSAATTSGLVVNY
PNPNILNPNRNASRAEVAALVYQGMVESGKVEPMPSQYLVKP
Download sequence
Identical sequences K9WMY4
WP_015185247.1.75295 gi|428313543|ref|YP_007124520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]