SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015186048.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015186048.1.75295
Domain Number 1 Region: 86-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.3e-23
Family Translational machinery components 0.00035
Further Details:      
 
Domain Number 2 Region: 15-82
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.66e-19
Family Ribosomal S5 protein, N-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015186048.1.75295
Sequence length 173
Comment 30S ribosomal protein S5 [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MATRRKSNRAKEKETTWQERVIQIRRVSKVVKGGKKLSFRAIVVVGNERGQVGVGVGKAS
DVIGAVRKGVADGKKQLIDVPLTKSNSIPHPSNGAAVGAKVMMRPAAPGTGVIAGGAVRT
VLELAGVRNILAKQLGSNNPLNNARAAVNALDSLRTFSEVAEERGVPIENLYA
Download sequence
Identical sequences K9WND5
gi|428314349|ref|YP_007125326.1| WP_015186048.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]