SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015193543.1.48393 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015193543.1.48393
Domain Number - Region: 115-176
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00301
Family Apolipoprotein 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015193543.1.48393
Sequence length 180
Comment hypothetical protein [Stanieria cyanosphaera]; AA=GCF_000317575.1; RF=representative genome; TAX=111780; STAX=102116; NAME=Stanieria cyanosphaera PCC 7437; strain=PCC 7437; AL=Complete Genome; RT=Major
Sequence
MKKLIEKVKSWNLNRIFIIFLAGSLLVLSTACGQGNVASTPSGVEKSLSKNYDTNQVSQN
RKDVFSDDERDVQFKAQTTQVPQGGMNLFNDDPRYDNPNVQAQSKSLVEQSKFRDEKYNN
VGDYVNNVTDSAAKNLEQTKEDLTQGAKERTRALQRNLETASENAKNAAENVKENLPDLT
Download sequence
Identical sequences K9XTE6
WP_015193543.1.48393 gi|434398837|ref|YP_007132841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]