SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015225808.1.10129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015225808.1.10129
Domain Number 1 Region: 291-540
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.44e-41
Family ABC transporter ATPase domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 67-283
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.22e-18
Family DNA repair protein MutS, domain III 0.018
Further Details:      
 
Domain Number 3 Region: 737-811
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000114
Family Smr domain 0.0076
Further Details:      
 
Weak hits

Sequence:  WP_015225808.1.10129
Domain Number - Region: 530-640
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.034
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015225808.1.10129
Sequence length 812
Comment endonuclease MutS2 [Halothece sp. PCC 7418]; AA=GCF_000317635.1; RF=na; TAX=65093; STAX=65093; NAME=Halothece sp. PCC 7418; strain=PCC 7418; AL=Complete Genome; RT=Major
Sequence
MIEAETLDLLEWRRLGEHLATFTSTKLGAYAARHLPIPDNRETSLTLLTETKEVYALEEN
LTSGWKFDGIYDFSSALERAEYKGILEGETLLQIATTLAGMRRLRRVIDELEDSPRLKEL
ISQIRTYPELEKEINRCLDDKGKVTERASPKLGEIRQNLKERRDRIYQKLQNIMQQQSGA
IQEPVITQRGERFVLPVKAGHKESIRGIVHDSSGSGATLYIEPNSIVELGNQQRQYLRQE
KREEERILQALTEEVAEVKEDLELLLAIATKLDLATARSRYSLWLEANPPQFVESNSREP
ITLRRLRHPLLVWQHHHEQGTPVVPIDVQIDPETRVVAITGPNTGGKTVTLKTVGLAALM
AKVGLFIPAKEPVEIPWFEQVLADIGDEQSIEQSLSTFSGHIRRITRIIDALHPSSIDHP
EANEDADGETIKLSLVLLDEVGAGTDPAEGSAIAIALLQYLAARVRLTIATTHYGELKAL
KYQDERFENASVEFDDETLSPTYRLLWGIPGRSNALTIARRLGLDPEILDLAKNKMGGYS
EDINQVISGLEKQRREQEEKAREARQLLEQAEKFYQEVSSRAKALEAREADLKRSQEQAV
NEAVSEARQEIAQVIKQLQQGQKTGQAAQKATATVNEIAGRHRPQPETPKPKPQYQPQVG
EQVRLPKFNQTGEVLTAPNAEGKLTIRFGLMKMTVSLADIESLDGKKPELPQKQQKASTS
TPKKSASEAPTVRTESNTLDIRGYRVAQAESQLENTIRSQNRGALWVIHGKGTGKLRQGV
QEFLKQHPQVERYETAPQNEGGSGVTVAYLKS
Download sequence
Identical sequences K9YCU2
WP_015225808.1.10129 gi|428776360|ref|YP_007168147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]