SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015226086.1.10129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015226086.1.10129
Domain Number 1 Region: 100-294
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.13e-52
Family BC ATP-binding domain-like 0.00053
Further Details:      
 
Domain Number 2 Region: 3-94
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.58e-20
Family BC N-terminal domain-like 0.0073
Further Details:      
 
Domain Number 3 Region: 301-370
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000118
Family BC C-terminal domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015226086.1.10129
Sequence length 376
Comment 5-(carboxyamino)imidazole ribonucleotide synthase [Halothece sp. PCC 7418]; AA=GCF_000317635.1; RF=na; TAX=65093; STAX=65093; NAME=Halothece sp. PCC 7418; strain=PCC 7418; AL=Complete Genome; RT=Major
Sequence
MSQRVGVIGGGQLAWMMGQEAQKLGVSFWVQAAHSDDPAVSIAENSIIAPLSDLEATAQL
AENCDVITFENEFIDQSGLSRLRDRVAFRPSLASLAPLLDKYEQRCYLQELGLPVPAFKT
VIAGETEFPVEELPVVAKVRRHGYDGQGTFIIPDQWSLDQVWETLKGEQVLLENFIPFES
ELAIMAARGVNGETVTYPVVETYQRHQVCQRVIVPARISETLEAEIRAIAQTILSALDWV
GIFGIELFLTEDHHILVNEIAPRTHNSGHYTLDACDVSQFAMHLKAVTGETLTAPQMQAK
AAVMVNLLGYESTENQYLDKRQQLSSLPNTYVYWYGKTQARPGRKLGHVTVLGESIAQAS
AIADQVSEIWYPHDDN
Download sequence
Identical sequences K9YB94
gi|428776638|ref|YP_007168425.1| WP_015226086.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]